Structure of PDB 8b87 Chain B Binding Site BS01

Receptor Information
>8b87 Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIEEEELTLTILRQTGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAAR
AGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b87 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R721 E724
Binding residue
(residue number reindexed from 1)
R1 E4
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b87, PDBe:8b87, PDBj:8b87
PDBsum8b87
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]