Structure of PDB 8b82 Chain B Binding Site BS01

Receptor Information
>8b82 Chain B (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIF
ISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQM
RVWRERM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8b82 Crystal structure of Scribble PDZ1 with human papillomavirus strain 16 E6 peptide
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G737 L738 G739 I740 S741 I742 A743 G747 S748 T749 S761 R762 H793 H794 V797
Binding residue
(residue number reindexed from 1)
G28 L29 G30 I31 S32 I33 A34 G38 S39 T40 S52 R53 H84 H85 V88
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8b82, PDBe:8b82, PDBj:8b82
PDBsum8b82
PubMed
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]