Structure of PDB 8ap1 Chain B Binding Site BS01

Receptor Information
>8ap1 Chain B (length=339) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVL
DLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRD
PYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWL
SCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTD
TKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPID
FDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKK
CPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQTEHS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ap1 Structures illustrate step-by-step mitochondrial transcription initiation
Resolution3.47 Å
Binding residue
(original residue number in PDB)		K15 Y103 W105 G145 M148 Q149 K179 S190 K191 Y335
Binding residue
(residue number reindexed from 1)		K14 Y102 W104 G144 M147 Q148 K178 S189 K190 Y334
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0008168 methyltransferase activity
GO:0034246 mitochondrial transcription factor activity
Biological Process
GO:0006390 mitochondrial transcription
GO:0006391 transcription initiation at mitochondrial promoter
GO:0032259 methylation
GO:0032786 positive regulation of DNA-templated transcription, elongation
Cellular Component
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0005759 mitochondrial matrix
GO:0034245 mitochondrial DNA-directed RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ap1, PDBe:8ap1, PDBj:8ap1
PDBsum8ap1
PubMed37821701
UniProtP14908|MTF1_YEAST Mitochondrial transcription factor 1 (Gene Name=MTF1)

[Back to BioLiP]