Structure of PDB 8amd Chain B Binding Site BS01

Receptor Information
>8amd Chain B (length=333) Species: 1313 (Streptococcus pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEISKKFGAEREKALNDALKLIEKDFGKGSIMRLGERAEQKVQVMSSGSL
ALDIALGSGGYPKGRIIEIYGPESSGKTTVALHAVAQAQKEGGIAAFIDA
EHALDPAYAAALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDS
VAALVPRAEIDGDIGDSHVGLQARMMSQAMRKLGASINKTKTIAIFINQL
REKVGVMFGNPETTPGGRALKFYASVRLDVRGNTQIKGTGDQKETNVGKE
TKIKVVKNKVAPPFKEAVVEIMYGEGISKTGELLKIASDLDIIKKAGAWY
SYKDEKIGQGSENAKKYLAEHPEIFDEIDKQVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8amd Assembly mechanism and cryoEM structure of RecA recombination nucleofilaments from Streptococcus pneumoniae.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		G178 S185 R209 E210 K211 V212 G225 R226
Binding residue
(residue number reindexed from 1)		G170 S177 R201 E202 K203 V204 G217 R218
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0009432 SOS response
GO:0030420 establishment of competence for transformation
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8amd, PDBe:8amd, PDBj:8amd
PDBsum8amd
PubMed36806960
UniProtP0A452|RECA_STRR6 Protein RecA (Gene Name=recA)

[Back to BioLiP]