Structure of PDB 8alm Chain B Binding Site BS01

Receptor Information
>8alm Chain B (length=171) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQF
FPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAF
KLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAM
MDKNADGKLTLQEFQEGSKAD
Ligand information
>8alm Chain P (length=28) Species: 10116 (Rattus norvegicus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SVPRFIKYTGYGNAAGLLAARGLMAGGR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8alm The neuronal calcium sensor NCS-1 regulates the phosphorylation state and activity of the Ga chaperone and GEF Ric-8A.
Resolution1.85402 Å
Binding residue
(original residue number in PDB)		W30 G33 D37 I51 Y52 F55 F72 F85 A88 L89 T92 W103 Y108 V125 R148 I152 M156 F169 G172
Binding residue
(residue number reindexed from 1)		W25 G28 D32 I46 Y47 F50 F67 F80 A83 L84 T87 W98 Y103 V120 R143 I147 M151 F164 G167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005245 voltage-gated calcium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008048 calcium sensitive guanylate cyclase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0010975 regulation of neuron projection development
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0030424 axon
GO:0030425 dendrite
GO:0043231 intracellular membrane-bounded organelle
GO:0045202 synapse
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8alm, PDBe:8alm, PDBj:8alm
PDBsum8alm
PubMed38018500
UniProtP62166|NCS1_HUMAN Neuronal calcium sensor 1 (Gene Name=NCS1)

[Back to BioLiP]