Structure of PDB 8aht Chain B Binding Site BS01

Receptor Information
>8aht Chain B (length=140) Species: 5833 (Plasmodium falciparum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEIDTDGNGTIDFPEFLTLMARKLKDTELIEAFRVFDRDGDGYISADELR
HVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFVKMMI
Ligand information
>8aht Chain G (length=24) Species: 7460 (Apis mellifera) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIGAVLKVLTTGLPALISWIKRKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aht Structures of calmodulin-melittin complexes show multiple binding modes lacking classical anchoring interactions.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		E7 E11 E14 M36 L39 Q41 K75 M109 E114 E120 E123 M124 E127 M144 M145
Binding residue
(residue number reindexed from 1)		E5 E9 E12 M34 L37 Q39 K73 M103 E108 E114 E117 M118 E121 M138 M139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0008047 enzyme activator activity
GO:0046872 metal ion binding
GO:0061891 calcium ion sensor activity
Cellular Component
GO:0005737 cytoplasm
GO:0020007 apical complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8aht, PDBe:8aht, PDBj:8aht
PDBsum8aht
PubMed36906144
UniProtP62203|CALM_PLAF7 Calmodulin (Gene Name=CAM)

[Back to BioLiP]