Structure of PDB 8afz Chain B Binding Site BS01

Receptor Information
>8afz Chain B (length=376) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDT
LIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQEL
EAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKN
TKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCV
KADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRK
VEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDK
ARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIE
MSELEIKHARNNVSLLQSCIDLFKNN
Ligand information
>8afz Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SNVSYKYSKVEWLMEEIQLP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8afz Architecture of the ESCPE-1 membrane coat.
Resolution10.0 Å
Binding residue
(original residue number in PDB)		P36 D37 A38 L39 S40 R42 Y132 L133 F136 K137
Binding residue
(residue number reindexed from 1)		P8 D9 A10 L11 S12 R14 Y104 L105 F108 K109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0010314 phosphatidylinositol-5-phosphate binding
GO:0031748 D1 dopamine receptor binding
GO:0034452 dynactin binding
GO:0035091 phosphatidylinositol binding
GO:0045296 cadherin binding
GO:0070273 phosphatidylinositol-4-phosphate binding
GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
Biological Process
GO:0006886 intracellular protein transport
GO:0006897 endocytosis
GO:0006907 pinocytosis
GO:0007174 epidermal growth factor catabolic process
GO:0015031 protein transport
GO:0016241 regulation of macroautophagy
GO:0042147 retrograde transport, endosome to Golgi
GO:0045776 negative regulation of blood pressure
GO:0045893 positive regulation of DNA-templated transcription
GO:0046628 positive regulation of insulin receptor signaling pathway
Cellular Component
GO:0001726 ruffle
GO:0001891 phagocytic cup
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005903 brush border
GO:0009898 cytoplasmic side of plasma membrane
GO:0030904 retromer complex
GO:0030905 retromer, tubulation complex
GO:0031410 cytoplasmic vesicle
GO:0031901 early endosome membrane
GO:0042995 cell projection
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0070685 macropinocytic cup
GO:0097422 tubular endosome
GO:0098559 cytoplasmic side of early endosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8afz, PDBe:8afz, PDBj:8afz
PDBsum8afz
PubMed37322239
UniProtQ9Y5X3|SNX5_HUMAN Sorting nexin-5 (Gene Name=SNX5)

[Back to BioLiP]