Structure of PDB 8aed Chain B Binding Site BS01

Receptor Information
>8aed Chain B (length=160) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLGKKLLEAAYYGQLDEVRILMANGADVNAVDVHGITPLHLAAYFGHLEI
VEVLLKTGADVNARDNRGITPLHLAAAMGHLEIVEVLLKAGADVNAFDEA
GDTPLHLAALKGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDIA
EVLQKAAKLN
Ligand information
>8aed Chain D (length=22) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKSIRIGPGQAFYATGDIIGDI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8aed Trapping the HIV-1 V3 loop in a helical conformation enables broad neutralization.
Resolution1.17 Å
Binding residue
(original residue number in PDB)
Y13 H36 Y46 F47 D67 R69 I71 L76 A79 D100 D104 L109 L112 K113 F135
Binding residue
(residue number reindexed from 1)
Y11 H34 Y44 F45 D65 R67 I69 L74 A77 D98 D102 L107 L110 K111 F133
External links