Structure of PDB 8a50 Chain B Binding Site BS01

Receptor Information
>8a50 Chain B (length=30) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFVKVRKKDLERLTTEVMQIRDFLPRILNG
Ligand information
>8a50 Chain A (length=29) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EFVKVRKKDLERLTTEVMQIRDFLPRILN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a50 BRCA2-HSF2BP oligomeric ring disassembly by BRME1 promotes Homologous Recombination
Resolution1.484 Å
Binding residue
(original residue number in PDB)
E1 F2 V3 V5 R6 K8 L10
Binding residue
(residue number reindexed from 1)
E1 F2 V3 V5 R6 K8 L10
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8a50, PDBe:8a50, PDBj:8a50
PDBsum8a50
PubMed37889963
UniProtO75031|HSF2B_HUMAN Heat shock factor 2-binding protein (Gene Name=HSF2BP)

[Back to BioLiP]