Structure of PDB 7zqs Chain B Binding Site BS01

Receptor Information
>7zqs Chain B (length=639) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYV
ENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGY
VAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVA
NAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHT
QFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSE
SKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKS
GVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEG
YLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTG
QFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTT
MDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLL
SFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRF
VMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLR
KQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zqs Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
Resolution2.54 Å
Binding residue
(original residue number in PDB)		L619 R623 R629 Y643 R646 G647 F650 R651
Binding residue
(residue number reindexed from 1)		L500 R504 R510 Y524 R527 G528 F531 R532
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001618 virus receptor activity
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004998 transferrin receptor activity
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030544 Hsp70 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0051087 protein-folding chaperone binding
Biological Process
GO:0001558 regulation of cell growth
GO:0001666 response to hypoxia
GO:0001934 positive regulation of protein phosphorylation
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006897 endocytosis
GO:0006953 acute-phase response
GO:0007165 signal transduction
GO:0007584 response to nutrient
GO:0010039 response to iron ion
GO:0010042 response to manganese ion
GO:0010628 positive regulation of gene expression
GO:0010637 negative regulation of mitochondrial fusion
GO:0030316 osteoclast differentiation
GO:0030890 positive regulation of B cell proliferation
GO:0031334 positive regulation of protein-containing complex assembly
GO:0031623 receptor internalization
GO:0032526 response to retinoic acid
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0033572 transferrin transport
GO:0035556 intracellular signal transduction
GO:0042102 positive regulation of T cell proliferation
GO:0042127 regulation of cell population proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045780 positive regulation of bone resorption
GO:0045830 positive regulation of isotype switching
GO:0046688 response to copper ion
GO:0046718 symbiont entry into host cell
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0060586 multicellular organismal-level iron ion homeostasis
GO:0071466 cellular response to xenobiotic stimulus
GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0150104 transport across blood-brain barrier
GO:1900182 positive regulation of protein localization to nucleus
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005768 endosome
GO:0005769 early endosome
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0030669 clathrin-coated endocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042470 melanosome
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0072562 blood microparticle
GO:0098794 postsynapse
GO:0098944 postsynaptic recycling endosome membrane
GO:0098978 glutamatergic synapse
GO:1903561 extracellular vesicle
GO:1990712 HFE-transferrin receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zqs, PDBe:7zqs, PDBj:7zqs
PDBsum7zqs
PubMed35875870
UniProtP02786|TFR1_HUMAN Transferrin receptor protein 1 (Gene Name=TFRC)

[Back to BioLiP]