Structure of PDB 7zl4 Chain B Binding Site BS01

Receptor Information
>7zl4 Chain B (length=155) Species: 470 (Acinetobacter baumannii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVTGQVDVKLNISTGCTVGGSQTEGNMNKFGTLNFGKTSGTWNNVLTAEV
ASAATGGNISVTCDGTDPVDFTVAIDGGERTDRTLKNTASADVVAYNVYR
DAARTNLYVVNQPQQFTTVSGQATAVPIFGAIAPNTGTPKAQGDYKDTLL
VTVNF
Ligand information
>7zl4 Chain D (length=14) Species: 470 (Acinetobacter baumannii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVTGQVDVKLNIST
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zl4 Archaic chaperone-usher pili self-secrete into superelastic zigzag springs.
Resolution3.45 Å
Binding residue
(original residue number in PDB)		F35 T47
Binding residue
(residue number reindexed from 1)		F35 T47
Enzymatic activity
Enzyme Commision number ?
External links