Structure of PDB 7zjw Chain B Binding Site BS01

Receptor Information
>7zjw Chain B (length=204) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKQQPQDNFKNNVKKSQLPVQLDLGGMLTALEKKQHSQHAKQSSKPVVHS
RRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLG
LREVLKHLKLRKLKCIIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFV
FALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTM
LENV
Ligand information
>7zjw Chain S (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caugacggucugccugaaaaccagcccgcugguggggcagucccga
......<<.<<........<<<<<....>>>>>.....>>.>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T457 L675 G676 L677 R678 R731 P743 V744
Binding residue
(residue number reindexed from 1)		T29 L99 G100 L101 R102 R155 P167 V168
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0035368 selenocysteine insertion sequence binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0001514 selenocysteine incorporation
GO:0006401 RNA catabolic process
GO:0006412 translation
GO:0021756 striatum development
GO:0021884 forebrain neuron development
GO:0048255 mRNA stabilization
GO:2000623 negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtQ96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 (Gene Name=SECISBP2)

[Back to BioLiP]