Structure of PDB 7zie Chain B Binding Site BS01

Receptor Information
>7zie Chain B (length=185) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTKAIRLQKKINEARSAKKNLQQQIKDISTQHKTLSKQRKFEEKARSKIH
KLAPGNFYSMFQKKRAGDSVAEFYQFPEEEKAKWIAARDAYWEKAKSYFT
PKPKLGANGFAKYVQENYIRGDSLTETMKKLADEWNALSETEKQQYQISK
EDKEKYKKALEKWKELRLKEYSDYLKFKENYKVED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zie Towards automated crystallographic structure refinement with phenix.refine.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		K162 L163 A165 A169 V172 Q173 Y176 L182 M186
Binding residue
(residue number reindexed from 1)		K104 L105 A107 A111 V114 Q115 Y118 L124 M128
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0090139 mitochondrial chromosome packaging
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zie, PDBe:7zie, PDBj:7zie
PDBsum7zie
PubMed
UniProtQ59QB8

[Back to BioLiP]