Structure of PDB 7zgp Chain B Binding Site BS01

Receptor Information
>7zgp Chain B (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLIHPDTAKYPFKFEPFLRQEYSFSLDPDRPICEFYNSREGPKSCPRGPL
CPKKHVLPIFQNKIVCRHWLRGLCKKNDQCEYLHEYNLRKMPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zgp Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		I65 C67 R68 H69 L74 C75 K76 E82 Y83
Binding residue
(residue number reindexed from 1)		I64 C66 R67 H68 L73 C74 K75 E81 Y82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006397 mRNA processing
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zgp, PDBe:7zgp, PDBj:7zgp
PDBsum7zgp
PubMed35584695
UniProtQ06102|YTH1_YEAST mRNA 3'-end-processing protein YTH1 (Gene Name=YTH1)

[Back to BioLiP]