Structure of PDB 7zfr Chain B Binding Site BS01

Receptor Information
>7zfr Chain B (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATPENYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTEL
GRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSP
SKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zfr Machine learning predictions of MHC-II specificities reveal alternative binding mode of class II epitopes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
G11 Q13 F24 Y28 Y35 W59 I65 K69 V76 H79 N80 L83 D84
Binding residue
(residue number reindexed from 1)
G10 Q12 F23 Y27 Y34 W58 I64 K68 V75 H78 N79 L82 D83
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Tue Nov 26 22:02:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7zfr', asym_id = 'B', bs = 'BS01', title = 'Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7zfr', asym_id='B', bs='BS01', title='Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7zfr', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7zfr', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>