Structure of PDB 7zak Chain B Binding Site BS01

Receptor Information

>7zak Chain B (length=178) Species: 9606 (Homo sapiens)

TPENYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELG
RPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPS
NLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLE
MTPQQGDVYICQVEHTSLDSPVTVEWKA

Ligand information

>7zak Chain C (length=15) Species: 9606 (Homo sapiens)

KNLEKYKGKFVREID

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7zak Machine learning predictions of MHC-II specificities reveal alternative binding mode of class II epitopes.
• Resolution: 1.62 Å
• Binding residue (original residue number in PDB): G11 R12 Q13 Y28 Y35 A55 W59 K69 R75 H79 N80 L83 D84
• Binding residue (residue number reindexed from 1): G9 R10 Q11 Y26 Y33 A53 W57 K67 R73 H77 N78 L81 D82

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Feb 17 10:19:39 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7zak', asym_id = 'B', bs = 'BS01', title = 'Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7zak', asym_id='B', bs='BS01', title='Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7zak', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7zak', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>