Structure of PDB 7z26 Chain B Binding Site BS01

Receptor Information
>7z26 Chain B (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENLYFQHMKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSM
NGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRW
IFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7z26 Fragment Ligands of the m 6 A-RNA Reader YTHDF2.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		K416 S417 Y418 D422 W432 C433 N462 G463 W486 W491 T524 N525 S526 R527 D528
Binding residue
(residue number reindexed from 1)		K17 S18 Y19 D23 W33 C34 N63 G64 W87 W92 T125 N126 S127 R128 D129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:7z26, PDBe:7z26, PDBj:7z26
PDBsum7z26
PubMed36110386
UniProtQ9Y5A9|YTHD2_HUMAN YTH domain-containing family protein 2 (Gene Name=YTHDF2)

[Back to BioLiP]