Structure of PDB 7yx9 Chain B Binding Site BS01

Receptor Information
>7yx9 Chain B (length=193) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGSGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEY
RAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGAVESFTVQRRVEP
KVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGL
IQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yx9 MHC-II dynamics are maintained in HLA-DR allotypes to ensure catalyzed peptide exchange.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		W42 F46 Y80 D90 Y93 W94 R104 T110 Y111 H114 N115 A118 V119
Binding residue
(residue number reindexed from 1)		W12 F16 Y50 D60 Y63 W64 R74 T80 Y81 H84 N85 A88 V89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yx9, PDBe:7yx9, PDBj:7yx9
PDBsum7yx9
PubMed37142807
UniProtA0A4E9DJJ3

[Back to BioLiP]