Structure of PDB 7yun Chain B Binding Site BS01

Receptor Information
>7yun Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKA
VKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yun Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
Resolution2.13 Å
Binding residue
(original residue number in PDB)
L211 T212 A214 S216 K225 R253 R254 N261
Binding residue
(residue number reindexed from 1)
L38 T39 A41 S43 K52 R80 R81 N88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003714 transcription corepressor activity
Biological Process
GO:0045666 positive regulation of neuron differentiation
GO:0045746 negative regulation of Notch signaling pathway

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7yun, PDBe:7yun, PDBj:7yun
PDBsum7yun
PubMed37086783
UniProtQ5SZJ8|BEND6_HUMAN BEN domain-containing protein 6 (Gene Name=BEND6)

[Back to BioLiP]