Structure of PDB 7yf3 Chain B Binding Site BS01

Receptor Information
>7yf3 Chain B (length=266) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWAAIQAYHS
AVSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDL
GAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQ
YDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVG
GKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMY
NDYYVLDDAVFVLKPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yf3 Molecular basis for METTL9-mediated N1-histidine methylation
Resolution3.434 Å
Binding residue
(original residue number in PDB)		S105 G124 M126 N210 D213 R214 Y295 C297 D300 Y302 Y306 L308
Binding residue
(residue number reindexed from 1)		S53 G72 M74 N158 D161 R162 Y243 C245 D248 Y250 Y254 L256
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0106370 protein-L-histidine N-pros-methyltransferase activity
Biological Process
GO:0032259 methylation
Cellular Component
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yf3, PDBe:7yf3, PDBj:7yf3
PDBsum7yf3
PubMed37015930
UniProtQ9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)

[Back to BioLiP]