Structure of PDB 7y9c Chain B Binding Site BS01

Receptor Information
>7y9c Chain B (length=265) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWAAIQAYHSA
VSSAFSLAMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLG
AGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQY
DVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGG
KWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYN
DYYVLDDAVFVLKPV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y9c Molecular basis for METTL9-mediated N1-histidine methylation
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S105 N118 R123 G124 M126 N210 D213 R214 V241 L242 P243 H245 Y247 Q267 N268 W269 Q272 Y295 C297 D300 Y302 Y306 L308
Binding residue
(residue number reindexed from 1)		S52 N65 R70 G71 M73 N157 D160 R161 V188 L189 P190 H192 Y194 Q214 N215 W216 Q219 Y242 C244 D247 Y249 Y253 L255
Enzymatic activity
Enzyme Commision number 2.1.1.-
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0106370 protein-L-histidine N-pros-methyltransferase activity
Biological Process
GO:0032259 methylation
Cellular Component
GO:0005739 mitochondrion
GO:0005783 endoplasmic reticulum

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y9c, PDBe:7y9c, PDBj:7y9c
PDBsum7y9c
PubMed37015930
UniProtQ9H1A3|METL9_HUMAN Protein-L-histidine N-pros-methyltransferase (Gene Name=METTL9)

[Back to BioLiP]