Structure of PDB 7y3m Chain B Binding Site BS01

Receptor Information
>7y3m Chain B (length=55) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKCKYCSKVFGTDSSLQIHLRSHTGERPFVCSVCGHRFTTKGNLKVHFHR
HPQVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y3m Structural studies of SALL family protein zinc finger cluster domains in complex with DNA reveal preferential binding to an AATA tetranucleotide motif.
Resolution2.723 Å
Binding residue
(original residue number in PDB)		K389 H400 R408 F419 N424 H428 R431
Binding residue
(residue number reindexed from 1)		K8 H19 R27 F38 N43 H47 R50
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7y3m, PDBe:7y3m, PDBj:7y3m
PDBsum7y3m
PubMed36257403
UniProtQ9UJQ4|SALL4_HUMAN Sal-like protein 4 (Gene Name=SALL4)

[Back to BioLiP]