Structure of PDB 7xwz Chain B Binding Site BS01

Receptor Information
>7xwz Chain B (length=121) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGG
KDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNP
ANNAAIVLQLPQGTTLPKGFY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xwz Antiviral drug design based on structural insights into the N-terminal domain and C-terminal domain of the SARS-CoV-2 nucleocapsid protein.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R92 R107
Binding residue
(residue number reindexed from 1)		R45 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019013 viral nucleocapsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xwz, PDBe:7xwz, PDBj:7xwz
PDBsum7xwz
PubMed36317101
UniProtP0DTC9|NCAP_SARS2 Nucleoprotein (Gene Name=N)

[Back to BioLiP]