Structure of PDB 7xwo Chain B Binding Site BS01

Receptor Information
>7xwo Chain B (length=272) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMPSWQLALWATAYLALVLVAVTGNAIVIWIILAHRRMRTVTNYFIVNLA
LADLCMAAFNAAFNFVYASHWYFGRAFCYFQNLFPITAMFVSIYSMTAIA
ADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGA
TKCVVAWPGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRNLRHL
QAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLAL
FWLAMSSTMYNPIIYCCLNHRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xwo Neurokinin A bound to active human neurokinin 2 receptor in complex with G324
Resolution2.7 Å
Binding residue
(original residue number in PDB)		N86 Y93 T173 D175 C181 Y266 Y269 F270 Q286 Y289 F293
Binding residue
(residue number reindexed from 1)		N60 Y67 T145 D147 C153 Y224 Y227 F228 Q244 Y247 F251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004995 tachykinin receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0022900 electron transport chain
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xwo, PDBe:7xwo, PDBj:7xwo
PDBsum7xwo
PubMed35882833
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P21452

[Back to BioLiP]