Structure of PDB 7xv8 Chain B Binding Site BS01

Receptor Information
>7xv8 Chain B (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINK
HHRNRCQFCRLKKCLEMGMKMESVQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xv8 Structures of human TR4LBD-JAZF1 and TR4DBD-DNA complexes reveal the molecular basis of transcriptional regulation.
Resolution3.199 Å
Binding residue
(original residue number in PDB)		R127 H128 Y129 R146 Q188
Binding residue
(residue number reindexed from 1)		R14 H15 Y16 R33 Q75
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xv8, PDBe:7xv8, PDBj:7xv8
PDBsum7xv8
PubMed36651297
UniProtP49116|NR2C2_HUMAN Nuclear receptor subfamily 2 group C member 2 (Gene Name=NR2C2)

[Back to BioLiP]