Structure of PDB 7xur Chain B Binding Site BS01

Receptor Information
>7xur Chain B (length=363) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFPEYELPELNTRAFHVGAFGELWRGRLRGAGDLSLREPADSDREDAAVA
RDLDCSLEAAAELRAVCGLDKLDPEVIPENTDLVTLGVRKRFLEHREETI
TIDRACRQETFVYEMESHAIGKKPENSADMIEEGELILSVNILYPVIFHK
HKEHKPYQTMLVLGSQKLTQLRDSIRCVSDLQIGGEFSNTPDQISKDLYK
SAFFYFEGTFYNDKRYPECRDLSRTIIEWSESHDRGYGKFQTARMEDFTF
NDLCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHW
LWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGE
FLAYPYVDPGTFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xur Structural basis of human SNAPc recognizing proximal sequence element of snRNA promoter.
Resolution3.49 Å
Binding residue
(original residue number in PDB)
H193 K194 H195 W350
Binding residue
(residue number reindexed from 1)
H149 K150 H151 W302
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001006 RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0001046 core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003681 bent DNA binding
GO:0005515 protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006383 transcription by RNA polymerase III
GO:0009301 snRNA transcription
GO:0042795 snRNA transcription by RNA polymerase II
GO:0042796 snRNA transcription by RNA polymerase III
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0016604 nuclear body
GO:0019185 snRNA-activating protein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7xur, PDBe:7xur, PDBj:7xur
PDBsum7xur
PubMed36369505
UniProtQ92966|SNPC3_HUMAN snRNA-activating protein complex subunit 3 (Gene Name=SNAPC3)

[Back to BioLiP]