Structure of PDB 7xty Chain B Binding Site BS01

Receptor Information
>7xty Chain B (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGR
IHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xty Targeting PTPN13 with 11 amino acid peptides of C-terminal APC prevents immune evasion of colorectal cancer
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S1377 L1378 G1379 I1380 S1381 V1382 T1383 S1389 V1390 I1401 H1431 V1435 R1439
Binding residue
(residue number reindexed from 1)		S16 L17 G18 I19 S20 V21 T22 S28 V29 I40 H70 V74 R78
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:7xty, PDBe:7xty, PDBj:7xty
PDBsum7xty
PubMed
UniProtQ12923|PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 (Gene Name=PTPN13)

[Back to BioLiP]