Structure of PDB 7xp3 Chain B Binding Site BS01

Receptor Information
>7xp3 Chain B (length=148) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLPPGFRFHPTDEELITHYLKPKVFNTFFTAIGEVDLNKIEPWDLPWKMG
EKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKEIFKGKSLVGMKKT
LVFYKGRAPKGVKTNWVMHEYRLEGKYCIENLPQTAKNEWVICRVFQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xp3 Structural basis of DNA binding by the NAC transcription factor ORE1, a master regulator of plant senescence.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		G89 R91 K102 T104 G105 V124 Y126 K132 K135 H141
Binding residue
(residue number reindexed from 1)		G67 R69 K80 T82 G83 V102 Y104 K110 K113 H119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xp3, PDBe:7xp3, PDBj:7xp3
PDBsum7xp3
PubMed36564947
UniProtQ9FKA0|NAC92_ARATH NAC domain-containing protein 92 (Gene Name=NAC92)

[Back to BioLiP]