Structure of PDB 7xg4 Chain B Binding Site BS01

Receptor Information
>7xg4 Chain B (length=219) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNLKVTIDLSNPMMEPGDLLHLDALLGALRVSRARAEHGDAINPRDYHYD
LPLERYQAPSGDWVFKASAFKLKRQLPNQMWMQTGRLSIVEAARHRQSGY
LQLRAGKPNPAGGPFKTSIYHRPIVQAELTAFCVGDQQGIEALLSECRQI
GGKRGVGFGQVAGFKVEPVAETDCPWSWRALPADADPRLVTSEHARCIAA
IRGPYWDRTLHVEALAPTP
Ligand information
>7xg4 Chain I (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaacgguggagcaacaccugaaggaaggcuugaugagcguguuccccg
cauacgcgggg
..............................................<<<<
<....>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xg4 Type IV-A CRISPR-Csf complex: Assembly, dsDNA targeting, and CasDinG recruitment.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		D19 L20 L21 A25 L26 G28 A29 P45 R46 M83 Q84 T85 G86 R87 S89 S119 Y121 G153 K154 R155 G204 P205 Y206 W207 H212
Binding residue
(residue number reindexed from 1)		D18 L19 L20 A24 L25 G27 A28 P44 R45 M82 Q83 T84 G85 R86 S88 S118 Y120 G152 K153 R154 G203 P204 Y205 W206 H211
External links