Structure of PDB 7xg3 Chain B Binding Site BS01

Receptor Information
>7xg3 Chain B (length=219) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNLKVTIDLSNPMMEPGDLLHLDALLGALRVSRARAEHGDAINPRDYHYD
LPLERYQAPSGDWVFKASAFKLKRQLPNQMWMQTGRLSIVEAARHRQSGY
LQLRAGKPNPAGGPFKTSIYHRPIVQAELTAFCVGDQQGIEALLSECRQI
GGKRGVGFGQVAGFKVEPVAETDCPWSWRALPADADPRLVTSEHARCIAA
IRGPYWDRTLHVEALAPTP
Ligand information
>7xg3 Chain I (length=61) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaacgguggagcaacaccugaaggaaggcuugaugagcguguuccccg
cauacgcgggg
.............................................<<<<<
<....>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xg3 Type IV-A CRISPR-Csf complex: Assembly, dsDNA targeting, and CasDinG recruitment.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G18 D19 L20 L21 A25 L26 A29 V32 P45 R46 H49 M83 Q84 T85 G86 R87 Y121 Q150 G152 G153 K154 R155 A200 P205 Y206 W207 H212
Binding residue
(residue number reindexed from 1)		G17 D18 L19 L20 A24 L25 A28 V31 P44 R45 H48 M82 Q83 T84 G85 R86 Y120 Q149 G151 G152 K153 R154 A199 P204 Y205 W206 H211
External links