Structure of PDB 7xg1 Chain B Binding Site BS01

Receptor Information
>7xg1 Chain B (length=219) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VNLKVTIDLSNPMMEPGDLLHLDALLGALRVSRARAEHGDAINPRDYHYD
LPLERYQAPSGDWVFKASAFKLKRQLPNQMWMQTGRLSIVEAARHRQSGY
LQLRAGKPNPAGGPFKTSIYHRPIVQAELTAFCVGDQQGIEALLSECRQI
GGKRGVGFGQVAGFKVEPVAETDCPWSWRALPADADPRLVTSEHARCIAA
IRGPYWDRTLHVEALAPTP
Ligand information
>7xg1 Chain H (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugaacgguggagcaacaccugaagga
...........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xg1 Type IV-A CRISPR-Csf complex: Assembly, dsDNA targeting, and CasDinG recruitment
Resolution3.3 Å
Binding residue
(original residue number in PDB)		D19 L21 L26 A29 P45 R46 H49 M83 T85 G86 R87 S119 Y121 Q150 G152 K154 R155 A200 P205 Y206 W207
Binding residue
(residue number reindexed from 1)		D18 L20 L25 A28 P44 R45 H48 M82 T84 G85 R86 S118 Y120 Q149 G151 K153 R154 A199 P204 Y205 W206
External links