Structure of PDB 7x24 Chain B Binding Site BS01

Receptor Information

>7x24 Chain B (length=277) Species: 10116 (Rattus norvegicus)

TGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGL
TQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCG
SMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCII
IKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGN
IEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIEC
KAYGENIGYSEKDRFQGRFDVKIEVKS

Ligand information

• Ligand ID: CLR
• InChI: InChI=1S/C27H46O/c1-18(2)7-6-8-19(3)23-11-12-24-22-10-9-20-17-21(28)13-15-26(20,4)25(22)14-16-27(23,24)5/h9,18-19,21-25,28H,6-8,10-17H2,1-5H3/t19-,21+,22+,23-,24+,25+,26+,27-/m1/s1
• InChIKey: HVYWMOMLDIMFJA-DPAQBDIFSA-N
• SMILES:
  OpenEye OEToolkits 1.5.0: CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C
  CACTVS 3.341: CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC=C4C[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C
  ACDLabs 10.04: OC4CCC3(C(=CCC2C1C(C(C(C)CCCC(C)C)CC1)(C)CCC23)C4)C
  OpenEye OEToolkits 1.5.0: CC(C)CCC[C@@H](C)[C@H]1CC[C@@H]2[C@@]1(CC[C@H]3[C@H]2CC=C4[C@@]3(CC[C@@H](C4)O)C)C
  CACTVS 3.341: CC(C)CCC[CH](C)[CH]1CC[CH]2[CH]3CC=C4C[CH](O)CC[C]4(C)[CH]3CC[C]12C
• Formula: C27 H46 O
• Name: CHOLESTEROL
• ChEMBL: CHEMBL112570
• DrugBank: DB04540
• ZINC: ZINC000003875383
• PDB chain: 7x24 Chain B Residue 402

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7x24 Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): Y39 Y43
• Binding residue (residue number reindexed from 1): Y12 Y16
• Annotation score: 1

Gene Ontology

Molecular Function

• GO:0001671 ATPase activator activity
• GO:0005391 P-type sodium:potassium-exchanging transporter activity
• GO:0005515 protein binding
• GO:0019901 protein kinase binding
• GO:0030674 protein-macromolecule adaptor activity
• GO:0046982 protein heterodimerization activity
• GO:0051117 ATPase binding

Biological Process

• GO:0001666 response to hypoxia
• GO:0001824 blastocyst development
• GO:0006813 potassium ion transport
• GO:0006814 sodium ion transport
• GO:0006874 intracellular calcium ion homeostasis
• GO:0006883 intracellular sodium ion homeostasis
• GO:0007155 cell adhesion
• GO:0010248 establishment or maintenance of transmembrane electrochemical gradient
• GO:0010468 regulation of gene expression
• GO:0010882 regulation of cardiac muscle contraction by calcium ion signaling
• GO:0030001 metal ion transport
• GO:0030007 intracellular potassium ion homeostasis
• GO:0035725 sodium ion transmembrane transport
• GO:0036376 sodium ion export across plasma membrane
• GO:0045087 innate immune response
• GO:0046034 ATP metabolic process
• GO:0050821 protein stabilization
• GO:0055119 relaxation of cardiac muscle
• GO:0060048 cardiac muscle contraction
• GO:0072659 protein localization to plasma membrane
• GO:0086009 membrane repolarization
• GO:0098655 monoatomic cation transmembrane transport
• GO:1903169 regulation of calcium ion transmembrane transport
• GO:1903278 positive regulation of sodium ion export across plasma membrane
• GO:1903288 positive regulation of potassium ion import across plasma membrane
• GO:1990573 potassium ion import across plasma membrane

Cellular Component

• GO:0005886 plasma membrane
• GO:0005890 sodium:potassium-exchanging ATPase complex
• GO:0005901 caveola
• GO:0014704 intercalated disc
• GO:0016020 membrane
• GO:0016323 basolateral plasma membrane
• GO:0016324 apical plasma membrane
• GO:0016328 lateral plasma membrane
• GO:0030315 T-tubule
• GO:0031090 organelle membrane
• GO:0036126 sperm flagellum
• GO:0042383 sarcolemma

External links

• PDB: RCSB:7x24, PDBe:7x24, PDBj:7x24
• PDBsum: 7x24
• PubMed: 36085139
• UniProt: P07340|AT1B1_RAT Sodium/potassium-transporting ATPase subunit beta-1 (Gene Name=Atp1b1)