Structure of PDB 7x0y Chain B Binding Site BS01

Receptor Information
>7x0y Chain B (length=460) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKTIVWFRRDLRIEDNPALAAAAHEGSVFPVFIWCPEEEGQFYPGRASRW
WMKQSLAHLSQSLKALGSDLTLIKTHNTISAILDCIRVTGATKVVFNHLY
DPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSY
WKKCLDMSIESVMLPPPWRLMPITAAAEAIWACSIEELGLENEAEKPSNA
LLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNSTSLLSPYLHFG
EISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNF
PFTHEQSLLSHLRFFPWDADVDKFKAWRQGRTGYPLVDAGMRELWATGWM
HNRIRVIVSSFAVKFLLLPAKWGMKYFWDTLLDADLECDILGWQYISNPA
LQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNY
AKPIVDIDTA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x0y Cryo-EM structure of the CRY2 and CIB1 fragment complex provides insights into CIB1-mediated photosignaling.
Resolution3.89 Å
Binding residue
(original residue number in PDB)		H113 F302
Binding residue
(residue number reindexed from 1)		H109 F298
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0009881 photoreceptor activity
GO:0009882 blue light photoreceptor activity
GO:0016301 kinase activity
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:0071949 FAD binding
GO:0097159 organic cyclic compound binding
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006950 response to stress
GO:0006952 defense response
GO:0007623 circadian rhythm
GO:0009414 response to water deprivation
GO:0009416 response to light stimulus
GO:0009637 response to blue light
GO:0009638 phototropism
GO:0009646 response to absence of light
GO:0009785 blue light signaling pathway
GO:0009909 regulation of flower development
GO:0009911 positive regulation of flower development
GO:0010075 regulation of meristem growth
GO:0010118 stomatal movement
GO:0010244 response to low fluence blue light stimulus by blue low-fluence system
GO:0010617 circadian regulation of calcium ion oscillation
GO:0042752 regulation of circadian rhythm
GO:0046777 protein autophosphorylation
GO:0048574 long-day photoperiodism, flowering
GO:0051607 defense response to virus
GO:0072387 flavin adenine dinucleotide metabolic process
GO:1901371 regulation of leaf morphogenesis
GO:1902347 response to strigolactone
GO:2000028 regulation of photoperiodism, flowering
GO:2000379 positive regulation of reactive oxygen species metabolic process
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016604 nuclear body
GO:0016605 PML body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7x0y, PDBe:7x0y, PDBj:7x0y
PDBsum7x0y
PubMed36371635
UniProtQ96524|CRY2_ARATH Cryptochrome-2 (Gene Name=CRY2)

[Back to BioLiP]