Structure of PDB 7wm3 Chain B Binding Site BS01

Receptor Information
>7wm3 Chain B (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGF
GFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKL
FVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHD
PVDKIVLQKYHTINGHNAEVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wm3 Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.
Resolution1.62 Å
Binding residue
(original residue number in PDB)		E18 Q172 Y174 N181
Binding residue
(residue number reindexed from 1)		E4 Q158 Y160 N167
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:7wm3, PDBe:7wm3, PDBj:7wm3
PDBsum7wm3
PubMed36528084
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]