Structure of PDB 7wb3 Chain B Binding Site BS01

Receptor Information
>7wb3 Chain B (length=203) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPKPVSKRLVSYYMCLERLLDEGVEVVSSEELARRLDLKASQIRKDLSYF
GEFGKRGVGYNVEHLYDAIGEILGVKKEWKLVVVGAGNIGRAVANYTVMK
EKGFRIIGIFDSDPSKIGKEAAPGLTVSDVSELEKFVEEHGVEIGVIAVP
AEHAQEIAERLEKAGIKGILNFAPVKIKVSVPVENIDITASLRVLTFEIV
RRN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wb3 Structural Basis of Redox-Sensing Transcriptional Repressor Rex with Cofactor NAD + and Operator DNA.
Resolution2.401 Å
Binding residue
(original residue number in PDB)		P6 K7 P8 R12 R60
Binding residue
(residue number reindexed from 1)		P2 K3 P4 R8 R56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0051775 response to redox state
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wb3, PDBe:7wb3, PDBj:7wb3
PDBsum7wb3
PubMed35163512
UniProtQ9WY16|REX1_THEMA Redox-sensing transcriptional repressor Rex 1 (Gene Name=rex1)

[Back to BioLiP]