Structure of PDB 7vs4 Chain B Binding Site BS01

Receptor Information
>7vs4 Chain B (length=494) Species: 43263 (Pseudomonas alcaligenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEYQQHQASRLGKKKLEDLLWGAAEFLRGQIDASDYKQYIFPLLFYKRLS
DVYLEEYSEEGDASYAAMPMFHRFHIPQEARWEKVRDTRKNIGKAIQNAL
RLIETHNERLHGVFGDAQWTNKERLPDHLLADLIQHFSKIPLGIKSVAQD
DLGEAYEYLIKKFADDSGHTAAEFYTNRTVVHLMTRIMGLKPGETAYDPT
CGTGGMLLNAVMDLRNEGKEWRSVKLYGQEVNLLTSAIARMNMFLHEIEE
FEVLRGDTLAEPKFIEGDQLKQFDVIFANPPYSIKKWNRDKFAADPYGRN
LYGVPPQGCADYGFYTHIIKSLKPDTGRAAMLWPHGVLFRDSEQAIRKQV
IESDIIEAVIGLGPNLFYNSPMESCVVVLNCNKPAERKGKILFINGVEHV
TRERAHSRLSDDDLTVLIEAYSAPDKQPAITALVDIEVIRENQHNLSIPL
YVQAADNEEVHDIEHAIEAWKVSRVQLKKQTSKLFKSLAELGYE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vs4 Molecular insights into DNA recognition and methylation by non-canonical type I restriction-modification systems.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		K15 H175 A178 F180 N285 Y288 S289 F345 R346 S376 M378 R410
Binding residue
(residue number reindexed from 1)		K14 H169 A172 F174 N279 Y282 S283 F339 R340 S370 M372 R404
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 07:03:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7vs4', asym_id = 'B', bs = 'BS01', title = 'Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7vs4', asym_id='B', bs='BS01', title='Molecular insights into DNA recognition and meth...anonical type I restriction-modification systems.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003676,0003677,0008168,0008170,0032259', uniprot = '', pdbid = '7vs4', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0008168,0008170,0032259', uniprot='', pdbid='7vs4', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>