Structure of PDB 7vrl Chain B Binding Site BS01

Receptor Information
>7vrl Chain B (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMNTENKSQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSK
GFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYT
NG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vrl Two distinct binding modes provide the RNA-binding protein RbFox with extraordinary sequence specificity.
ResolutionN/A
Binding residue
(original residue number in PDB)		H120 S122 N123 I124 F126 I149 N151 R153 K156 G157 F158 F160 R184 T192 A193 R194
Binding residue
(residue number reindexed from 1)		H14 S16 N17 I18 F20 I43 N45 R47 K50 G51 F52 F54 R78 T86 A87 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000381 regulation of alternative mRNA splicing, via spliceosome
GO:0007399 nervous system development

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7vrl, PDBe:7vrl, PDBj:7vrl
PDBsum7vrl
PubMed36759600
UniProtQ9NWB1|RFOX1_HUMAN RNA binding protein fox-1 homolog 1 (Gene Name=RBFOX1)

[Back to BioLiP]