Structure of PDB 7vp2 Chain B Binding Site BS01

Receptor Information
>7vp2 Chain B (length=58) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDRHSKVFTSKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLIKK
AKTAIDKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vp2 Structural basis for DNA recognition by TCP transcription factors
Resolution1.92 Å
Binding residue
(original residue number in PDB)		R32 H33 S34 R45 R46 R68
Binding residue
(residue number reindexed from 1)		R3 H4 S5 R16 R17 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity

View graph for
Molecular Function
External links
PDB RCSB:7vp2, PDBe:7vp2, PDBj:7vp2
PDBsum7vp2
PubMed
UniProtO82277|TCP10_ARATH Transcription factor TCP10 (Gene Name=TCP10)

[Back to BioLiP]