Structure of PDB 7vjm Chain B Binding Site BS01

Receptor Information
>7vjm Chain B (length=72) Species: 1223260 (Pseudomonas phage JBD30) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTPDASNHDPDPRYLRGLLKKAGISQRRAAELLGLSDRVMRYYLSEDIKE
GYRPAPYTVQFALECLANDPPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vjm Structural basis for anti-CRISPR repression mediated by bacterial operon proteins Aca1 and Aca2.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R22 S31 Q32 R44 R47 Y48
Binding residue
(residue number reindexed from 1)		R16 S25 Q26 R38 R41 Y42
Enzymatic activity
Enzyme Commision number ?
External links