Structure of PDB 7vcq Chain B Binding Site BS01

Receptor Information
>7vcq Chain B (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVI
RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>7vcq Chain K (length=19) Species: 82830 (Epstein-barr virus strain ag876) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEIDLEEEDESDYSESDED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vcq Epstein-Barr Virus Tegument Protein BKRF4 is a Histone Chaperone.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R19 K20 V21 L22 R23 D24 N25 I26 K31 R39 V43 K44 R45 I46 Y51 R55
Binding residue
(residue number reindexed from 1)		R3 K4 V5 L6 R7 D8 N9 I10 K15 R23 V27 K28 R29 I30 Y35 R39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0032200 telomere organization
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vcq, PDBe:7vcq, PDBj:7vcq
PDBsum7vcq
PubMed35870648
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]