Structure of PDB 7va6 Chain B Binding Site BS01

Receptor Information

>7va6 Chain B (length=176) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MQNPQNLIWIALEMTGLDPDRDVIIEMATIVTDSDLNTLAEGPVIAIHQP
EEILAGMDEWNTRQHGQSGLTQRVRESTVSMAEAEAQTLAFLEQWVPKRS
SPICGNSICQDRRFLYRHMPRLEGYFHYRNLDVSTLKELAARWAPQVRES
FTHLALDDIRESIAELRHYRDHFIKL

Ligand information

>7va6 Chain C (length=2) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7va6 PaOrn Oligoribonuclease D11A mutant with RNA GU complex structure
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Y128 R129
Binding residue (residue number reindexed from 1)	Y128 R129

Enzymatic activity

Enzyme Commision number

3.1.15.-

Gene Ontology

	Molecular Function
GO:0000175	3'-5'-RNA exonuclease activity
GO:0003676	nucleic acid binding
GO:0004527	exonuclease activity
GO:0016896	RNA exonuclease activity, producing 5'-phosphomonoesters

	Biological Process
GO:0006259	DNA metabolic process

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7va6, PDBe:7va6, PDBj:7va6
PDBsum	7va6
PubMed
UniProt	P57665\|ORN_PSEAE Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]