Structure of PDB 7va3 Chain B Binding Site BS01

Receptor Information
>7va3 Chain B (length=180) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQNPQNLIWIALEMTGLDPDRDVIIEMATIVTDSDLNTLAEGPVIAIHQP
EEILAGMDEWNTRQHGQSGLTQRVRESTVSMAEAEAQTLAFLEQWVPKRS
SPICGNSICQDRRFLYRHMPRLEGYFHYRNLDVSTLKELAARWAPQVRES
FKKGNTHLALDDIRESIAELRHYRDHFIKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7va3 PaOrn Oligoribonuclease D11A mutant with substrate pGpG complex structure
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y128 R129
Binding residue
(residue number reindexed from 1)		Y128 R129
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0016896 RNA exonuclease activity, producing 5'-phosphomonoesters
Biological Process
GO:0006259 DNA metabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7va3, PDBe:7va3, PDBj:7va3
PDBsum7va3
PubMed
UniProtP57665|ORN_PSEAE Oligoribonuclease (Gene Name=orn)

[Back to BioLiP]