Structure of PDB 7uxq Chain B Binding Site BS01

Receptor Information
>7uxq Chain B (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAPYAAALEH
Ligand information
>7uxq Chain D (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPALWMCVFAARQCYES
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uxq De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution2.89 Å
Binding residue
(original residue number in PDB)		Y56 E58 N63 V76 H78 M115 S117
Binding residue
(residue number reindexed from 1)		Y39 E41 N46 V59 H61 M98 S100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7uxq, PDBe:7uxq, PDBj:7uxq
PDBsum7uxq
PubMed36534810
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]