Structure of PDB 7ux9 Chain B Binding Site BS01

Receptor Information
>7ux9 Chain B (length=106) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSVSKSMKAGLQFPVGRITRFLKKGRYAQRLGGGAPVYMAAVLEYLAAEV
LELAGNAARDNKKSRIIPRHLLLAIRNDEELGKLLSGVTIAHGGVLPNIN
SVLLPK
Ligand information
>7ux9 Chain Y (length=141) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcacatatatacat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ux9 Chromatin remodeling of histone H3 variants by DDM1 underlies epigenetic inheritance of DNA methylation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S23 V24 K26 R41
Binding residue
(residue number reindexed from 1)		S2 V3 K5 R20
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0070828 heterochromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0000792 heterochromatin
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005721 pericentric heterochromatin
GO:0005730 nucleolus
GO:0009506 plasmodesma
GO:0009536 plastid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ux9, PDBe:7ux9, PDBj:7ux9
PDBsum7ux9
PubMed37643610
UniProtQ9FJE8|H2A7_ARATH Probable histone H2A.7 (Gene Name=At5g59870)

[Back to BioLiP]