Structure of PDB 7ujv Chain B Binding Site BS01

Receptor Information
>7ujv Chain B (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTD
GQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKL
GSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAK
VSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAIT
VWYFDADERARAKVKYLTG
Ligand information
>7ujv Chain A (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ELDLETLAPYIPMDGEDFQL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ujv Structure of PHD2 in complex with HIF2a-CODD
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 I251 R252 W258 D277 R281 N293 G294 R295 K297 Y310 H313 D315 P317 N318 R322 W389 Y390 F391 R396 K400 Y403
Binding residue
(residue number reindexed from 1)		Q52 L53 V54 S55 I64 R65 W71 D90 R94 N106 G107 R108 K110 Y123 H126 D128 P130 N131 R135 W202 Y203 F204 R209 K213 Y216
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:7ujv, PDBe:7ujv, PDBj:7ujv
PDBsum7ujv
PubMed38418569
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]