Structure of PDB 7uiq Chain B Binding Site BS01

Receptor Information

>7uiq Chain B (length=261) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEA
DASHCIQQILEAVLHCHQMGVVHRNLKPENLLLASKLAAVKLADFGLAIE
VEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPP
FWDEDQHRLYKQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITA
AEALKHPWISH

Ligand information

>7uiq Chain C (length=19) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RTLDSHASRMTQLKKQAAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7uiq CaMKII binds both substrates and activators at the active site.
Resolution	3.11 Å
Binding residue (original residue number in PDB)	E216 D217 Q218 Y222
Binding residue (residue number reindexed from 1)	E204 D205 Q206 Y210

Enzymatic activity

Enzyme Commision number

2.7.11.17: calcium/calmodulin-dependent protein kinase.

Gene Ontology

	Molecular Function
GO:0004672	protein kinase activity
GO:0005524	ATP binding

	Biological Process
GO:0006468	protein phosphorylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7uiq, PDBe:7uiq, PDBj:7uiq
PDBsum	7uiq
PubMed	35830796
UniProt	Q9UQM7\|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha (Gene Name=CAMK2A)

[Back to BioLiP]