Structure of PDB 7u0e Chain B Binding Site BS01

Receptor Information
>7u0e Chain B (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YELTQPPSVSVSPGQTARITCSGDALPKKYAYWYQQKSGQAPVLVIHEDD
KRPSGIPGRFSASSSGTTATLTISGAQVEDEADYYCYSTDTNDNHAFGSG
TKLTVLSQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKA
DSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS
TVEKTVAPTEC
Ligand information
>7u0e Chain D (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KRSFIEDLLFNK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7u0e ACE2-binding exposes the SARS-CoV-2 fusion peptide to broadly neutralizing coronavirus antibodies.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L27 K29 K30 Y31 Y33 D50 Y88 T90 D94 H96
Binding residue
(residue number reindexed from 1)		L26 K28 K29 Y30 Y32 D49 Y87 T89 D93 H95
External links