Structure of PDB 7tv4 Chain B Binding Site BS01

Receptor Information
>7tv4 Chain B (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYK
ADFQAERQAREKLAEKKELLQEQLEQLQREY
Ligand information
>7tv4 Chain K (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RWACQSCTFENEAAAVLCSICERPRLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tv4 Structural basis for the simultaneous recognition of NEMO and acceptor ubiquitin by the HOIP NZF1 domain.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Q266 K277
Binding residue
(residue number reindexed from 1)		Q7 K18
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7tv4, PDBe:7tv4, PDBj:7tv4
PDBsum7tv4
PubMed35851409
UniProtQ9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator (Gene Name=IKBKG)

[Back to BioLiP]