Structure of PDB 7to7 Chain B Binding Site BS01

Receptor Information
>7to7 Chain B (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHK
IIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLM
AQALEKIFLQKVAQMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7to7 BRD3-BD1 in complex with RaPID linear peptide 1xAcK.4XE (monoAcK.4xE)
Resolution1.93 Å
Binding residue
(original residue number in PDB)
W57 L68 N69 I122
Binding residue
(residue number reindexed from 1)
W32 L43 N44 I97
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7to7, PDBe:7to7, PDBj:7to7
PDBsum7to7
PubMed37992806
UniProtQ15059|BRD3_HUMAN Bromodomain-containing protein 3 (Gene Name=BRD3)

[Back to BioLiP]