Structure of PDB 7t86 Chain B Binding Site BS01

Receptor Information

>7t86 Chain B (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVQLVETGGGLVKPGGSLRLSCSASRFSFRDYYMTWIRQAPGKGPEWVSH
ISGSGSTIYYADSVRGRFTISRDNAKSSLYLQMDSLQADDTAVYYCARGG
RATSYYWVHWGPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKS

Ligand information

>7t86 Chain J (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DSDSD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7t86 Multivalent human antibody-centyrin fusion protein to prevent and treat Staphylococcus aureus infections.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y32 G100 R101 A102 T103
Binding residue (residue number reindexed from 1)	Y32 G100 R101 A102 T103

External links

PDB	RCSB:7t86, PDBe:7t86, PDBj:7t86
PDBsum	7t86
PubMed	37098341

[Back to BioLiP]